missing translation for 'onlineSavingsMsg'
Learn More
Learn More
enQuireBio™ Recombinant other Pramlintide Protein
A cDNA sequence encoding the Pramlintide was constructed and used to recombinantly synthesize the protein.
£99.15 - £550.00
Specifications
Name | Pramlintide Protein |
---|---|
Regulatory Status | Research Use Only |
Endotoxin Concentration | Not Determined. Testing recommended prior to use in cell culture and can be performed upon request. |
Product Type | Recombinant Protein |
Cross Reactivity | Other |
Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
15952599
|
enQuireBio™
QP13132-1MG |
1 mg |
£99.15
1mg |
Estimated Shipment: 14-06-2024 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||
15972599
|
enQuireBio™
QP13132-5MG |
5 mg |
£155.00
5mg |
Estimated Shipment: 14-06-2024 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||
15962599
|
enQuireBio™
QP13132-25MG |
25 mg |
£550.00
25mg |
Estimated Shipment: 14-06-2024 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||
Specifications
Pramlintide Protein | |
Not Determined. Testing recommended prior to use in cell culture and can be performed upon request. | |
Other | |
Untagged | |
The protein was lyophilized with no additives. |
Research Use Only | |
Recombinant Protein | |
E. coli | |
KCNTATCATNRLANFLVHSSNNFGPILPPTNVGSNTY-NH2 | |
Greater than 98.0% as determined by:(a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE. |