missing translation for 'onlineSavingsMsg'
Learn More

Print

enQuireBio™ Recombinant other Gliadin Gamma Wheat Protein

A cDNA sequence encoding the Gliadin Gamma Wheat was constructed and used to recombinantly synthesize the protein.

£170.83 - £1324.47

Specifications

Name	Gliadin Gamma Wheat Protein
Product Type	Recombinant Protein
Protein Tag	His
Host Species	E. coli
Cross Reactivity	Other

View More Specs

Products 3

Product Code	Brand	Quantity	Price	Quantity & Availability
Product Code	Brand	Quantity	Price	Quantity & Availability
15939008 View Documents Promotion Details missing translation for 'viewProductCertificates'	enQuireBio™ QP11985-100UG	100 μg	£170.83 100µg View alternative products Save Up to »	Estimated Shipment: 17-02-2022	Please sign in to purchase this item. Need a web account? Register with us today!
15959008 View Documents Promotion Details missing translation for 'viewProductCertificates'	enQuireBio™ QP11985-500UG	500 μg	£662.78 500µg View alternative products Save Up to »	Estimated Shipment: 17-02-2022	Please sign in to purchase this item. Need a web account? Register with us today!
15949008 View Documents Promotion Details missing translation for 'viewProductCertificates'	enQuireBio™ QP11985-1MG	1 mg	£1324.47 1mg View alternative products Save Up to »	Estimated Shipment: 17-02-2022	Please sign in to purchase this item. Need a web account? Register with us today!

Specifications

Specifications

Name	Gliadin Gamma Wheat Protein
Protein Tag	His
Cross Reactivity	Other
Purity	Protein is >90% pure.

Product Type	Recombinant Protein
Host Species	E. coli
Sequence	MKTLLILTILAMAITIGTANIQVDPSGQVQWLQQQLVPQLQQPLSQQPQQTFPQPQQTFPHQPQQQVPQPQQPQQPFLQPQQPFPQQPQQPFPQTQQPQQPFPQQPQQPFPQTQQPQQPFPQQPQQPFPQTQQPQQPFPQLQQPQQPFPQPQQQLPQPQQPQQSFPQQQRPFIQPSLQQQLNCKNILLQQSKPASLVSSLWSIIWPQSDCQVMRQQCCQQLAQIPQQLQCAAIHSVVHSIIMQQQQQQQQQQGIDIFLPLSQHEQVGQGSLVQGQGIIQPQQPAQLEAIRSLVLQTLPSMCNVYVPPECSIMRAPFASIVAGIGGQHHHHHH

Back to Top