missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant other Gliadin Gamma Wheat Protein

A cDNA sequence encoding the Gliadin Gamma Wheat was constructed and used to recombinantly synthesize the protein.

£170.83 - £1324.47

Specifications

Name Gliadin Gamma Wheat Protein
Product Type Recombinant Protein
Protein Tag His
Host Species E. coli
Cross Reactivity Other
View More Specs

Products 3
Product Code Brand Quantity Price Quantity & Availability  
Product Code Brand Quantity Price Quantity & Availability  
15939008
View Documents Promotion Details
enQuireBio™
QP11985-100UG
100 μg
£170.83
100µg
View alternative products
Save Up to 
»
Estimated Shipment: 17-02-2022
Please to purchase this item. Need a web account? Register with us today!
15959008
View Documents Promotion Details
enQuireBio™
QP11985-500UG
500 μg
£662.78
500µg
View alternative products
Save Up to 
»
Estimated Shipment: 17-02-2022
Please to purchase this item. Need a web account? Register with us today!
15949008
View Documents Promotion Details
enQuireBio™
QP11985-1MG
1 mg
£1324.47
1mg
View alternative products
Save Up to 
»
Estimated Shipment: 17-02-2022
Please to purchase this item. Need a web account? Register with us today!
Description

Description

Specifications

Specifications

Gliadin Gamma Wheat Protein
His
Other
Protein is >90% pure.
Recombinant Protein
E. coli
MKTLLILTILAMAITIGTANIQVDPSGQVQWLQQQLVPQLQQPLSQQPQQTFPQPQQTFPHQPQQQVPQPQQPQQPFLQPQQPFPQQPQQPFPQTQQPQQPFPQQPQQPFPQTQQPQQPFPQQPQQPFPQTQQPQQPFPQLQQPQQPFPQPQQQLPQPQQPQQSFPQQQRPFIQPSLQQQLNCKNILLQQSKPASLVSSLWSIIWPQSDCQVMRQQCCQQLAQIPQQLQCAAIHSVVHSIIMQQQQQQQQQQGIDIFLPLSQHEQVGQGSLVQGQGIIQPQQPAQLEAIRSLVLQTLPSMCNVYVPPECSIMRAPFASIVAGIGGQHHHHHH
SDS
Product Certifications