missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant Human SYK Protein

A cDNA sequence encoding the SYK was constructed and used to recombinantly synthesize the protein.

£98.39 - £1108.23

Specifications

Name SYK Protein
Product Type Recombinant Protein
Protein Tag Flag Tag
Host Species HEK 293
Cross Reactivity Human
View More Specs

Products 3
Product Code Brand Quantity Price Quantity & Availability  
Product Code Brand Quantity Price Quantity & Availability  
15954289
View Documents Promotion Details
enQuireBio™
QP13656-2UG
2 μg
£98.39
2µg
View alternative products
Save Up to 
»
Estimated Shipment: 18-02-2022
Please to purchase this item. Need a web account? Register with us today!
15944289
View Documents Promotion Details
enQuireBio™
QP13656-10UG
10 μg
£151.37
10µg
View alternative products
Save Up to 
»
Estimated Shipment: 18-02-2022
Please to purchase this item. Need a web account? Register with us today!
15934289
View Documents Promotion Details
enQuireBio™
QP13656-100UG
100 μg
£1108.23
100µg
View alternative products
Save Up to 
»
Estimated Shipment: 18-02-2022
Please to purchase this item. Need a web account? Register with us today!
Description

Description

Specifications

Specifications

SYK Protein
Flag Tag
Human
Greater than 85.0% as determined by SDS-PAGE.
SYK
Recombinant Protein
HEK 293
MHHHHHHDYKDDDDKKLMASSGMADSANHLPFFFGNITREEAEDYLVQGGMSDGL YLLRQSRNYLGGFALSVAHGRKAHHYTIERELNGTYAIAGGRTHASPADLCHYHSQES DGLVCLLKKPFNRPQGVQPKTGPFEDLKENLIREYVKQTWNLQGQALEQAIISQKPQL EKLIATTAHEKMPWFHGKISREESEQIVLIGSKTNGKFLIRARDNNGSYALCLLHEGKV LHYRIDKDKTGKLSIPEGKKFDTLWQLVEHYSYKADGLLRVLTVPCQKIGTQGNVNFG GRPQLPGSHPATWSAGGIISRIKSYSFPKPGHRKSSPAQGNRQESTVSFNPYEPELA PWAADKGPQREALPMDTEVYESPYADPEEIRPKEVYLDRKLLTLEDKELGSGNFGTV KKGYYQMKKVVKTVAVKILKNEANDPALKDELLAEANVMQQLDNPYIVRMIGICEAES WMLVMEMAELGPLNKYLQQNRHVKDKNIIELVHQVSMGMKYLEESNFVHRDLAARN VLLVTQHYAKISDFGLSKALRADENYYKAQTHGKWPVKWYAPECINYYKFSSKSDVW SFGVLMWEAFSYGQKPYRGMKGSEVTAMLEKGERMGCPAGCPREMYDLMNLCWT YDVENRPGFAAVELRLRNYYYDVVN
6850
SDS
Product Certifications