missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 18070474

Novus Biologicals™ Recombinant Human Rab5a Protein

Product Code. 18070474 Shop All Bio Techne Products
Click to view available options
:
0.1mg; Unlabeled
This item is not returnable. View return policy

Product Code. 18070474

Brand: Novus Biologicals™ NBC118504

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Highly purified. Generating reliable and reproducible results.

An un-tagged recombinant protein corresponding to the amino acids 1-215 of Human Rab5a The Recombinant Human Rab5a Protein is derived from E. coli. The Recombinant Human Rab5a Protein has been validated for the following applications: SDS-Page.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number NP_004153
For Use With (Application) ELISA, SDS-PAGE
Formulation 20mM Tris buffer (pH 8.0)
Gene ID (Entrez) 5868
Molecular Weight (g/mol) 23kDa
Name Rab5a Protein
Purification Method Protein
Immunogen MASRGATRPNGPNTGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQRQASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKKLPKNEPQNPGANSARGRGVDLTEPTQPTRNQCCSN
Storage Requirements −80°C. Avoid freeze-thaw cycles.
Cross Reactivity Human
Purity or Quality Grade >95%, by SDS-PAGE
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.