missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. Novus Biologicals™ Recombinant Human CLPS His Protein

Novus Biologicals™ Recombinant Human CLPS His Protein

Product Code. 18698466 Shop All Bio Techne Products
Click to view available options
Quantity:
0.1 mg
0.25 mg, 25 μL
Unit Size:
0.1mg
0.25mg
This item is not returnable. View return policy

Product Code. 18698466

Brand: Novus Biologicals™ NBP2516860.25mg

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Highly purified. Generating reliable and reproducible results.

A recombinant protein with a N-Terminal His-tag and corresponding to the amino acids 18-112 of Human CLPS The Recombinant Human CLPS Protein is derived from E. coli. The Recombinant Human CLPS Protein has been validated for the following applications: SDS-Page.
TRUSTED_SUSTAINABILITY

Specifications

Antigen TCL1B
Applications Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Concentration 0.25 mg/mL
Classification Polyclonal
For Use With (Application) SDS-PAGE
Formulation 20mM Tris-HCl buffer (pH8.0) containing 30% glycerol 1mM DTT, 0.1M NaCl, PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene ID (Entrez) 1208, 9623
Conjugate Unconjugated
Molecular Weight (g/mol) TMW: 12.5kDa
Dilution Western Blot 0.4 μg/mL, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin 1:20 - 1:50
Gene Alias Oncogene TCL1B, Oncogene TCL-1B, SYN-1, Syncytiotrophoblast-specific protein, T-cell leukemia/lymphoma 1B, T-cell leukemia/lymphoma protein 1B, T-cell lymphoma/leukemia 1B, TCL1, TCL1/MTCP1-like protein 1, TML1TCL1/ MTCP1-like 1, colipase, colipase, pancreatic, pancreatic colipase preproprotein
Quantity 0.25 mg, 25 μL
Gene Symbols TCL1B
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: WQMAVHTRELLSSGQMPFSQLPAVWQLYPGRKYRAADSSFWEIADHGQIDSMEQLVLTYQPE
Storage Requirements Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
Purification Method Affinity Purified
Regulatory Status RUO
Research Discipline Stem Cell Markers
Primary or Secondary Primary
Common Name CLPS
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
Isotype IgG
Recombinant Recombinant
Purity or Quality Grade >90%, by SDS-PAGE under reducing conditions and visualized by Colloidal Coomassie™ Blue stain
Show More Show Less

For research use only and is not approved for use in humans or in clinical diagnosis

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.