missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Novus Biologicals™ Recombinant Human alpha-Synuclein Monomer Protein (Biologically Active)
Shop All Bio Techne Products
Click to view available options
Quantity:
100 μg
200 μg
500 μg
Unit Size:
1 set
200µg
500µg
Description
An un-tagged full length Human biologically active Alpha-Synuclein recombinant protein monomer, NCBI Accession #:NP_000336.1. The Recombinant Human alpha-Synuclein Monomer Protein is derived from E. coli. The Recombinant Human alpha-Synuclein Monomer Protein has been validated for the following applications: Western Blot, In vitro assay, SDS-Page, Bioactivity.
Specifications
Specifications
| For Use With (Application) | In vitro Assay, In vivo Assay, SDS-PAGE, Western Blot |
| Formulation | PBS |
| Gene ID (Entrez) | 6622 |
| Name | Human alpha-Synuclein Monomer Protein |
| Purification Method | >95% pure by SDS-PAGE |
| Quantity | 100 μg |
| Source | E.Coli |
| Immunogen | MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA |
| Storage Requirements | Store at −80°C in the dark. Avoid freeze-thaw cycles. |
| Regulatory Status | RUO |
| Show More |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction