missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant HSV HSV-2 gB Protein

A cDNA sequence encoding the HSV-2 gB was constructed and used to recombinantly synthesize the protein.

£170.83 - £1324.47

Specifications

Name HSV HSV-2 gB Protein
Product Type Recombinant Protein
Protein Tag His
Host Species E. coli
Cross Reactivity HSV
View More Specs

Products 3
Product Code Brand Quantity Price Quantity & Availability  
Product Code Brand Quantity Price Quantity & Availability  
15930119
View Documents Promotion Details
enQuireBio™
QP12342-100UG
100 μg
£170.83
100µg
View alternative products
Save Up to 
»
Estimated Shipment: 17-02-2022
Please to purchase this item. Need a web account? Register with us today!
15950119
View Documents Promotion Details
enQuireBio™
QP12342-500UG
500 μg
£662.78
500µg
View alternative products
Save Up to 
»
Estimated Shipment: 17-02-2022
Please to purchase this item. Need a web account? Register with us today!
15940119
View Documents Promotion Details
enQuireBio™
QP12342-1MG
1 mg
£1324.47
1mg
View alternative products
Save Up to 
»
Estimated Shipment: 17-02-2022
Please to purchase this item. Need a web account? Register with us today!
Description

Description

Specifications

Specifications

HSV HSV-2 gB Protein
His
HSV
Protein is >90% pure as determined by SDS PAGE.
Recombinant Protein
E. coli
MIAPYKFKATMYYKDVTVSQVWFGHRYSQFMGIFEDRAPVPFEEVIDKINAKGVCRST AKYVRNNLETTAFHRDDHETDMELKPANAATRTSRGWHTTDLKYNPSRVEAFHRYGTTVNCIVEEVDARSVYPYDEFVLATGDFVYMSPFYGYREGSHTEHTSYAADRFKQVDGFYARDLTTKARATAPTTRNLLTTPKFTVAWDWVPKRPSVCTHHHHHH
SDS
Product Certifications