missing translation for 'onlineSavingsMsg'
Learn More
Learn More
enQuireBio™ Recombinant HIV-1 Integrase Protein
A cDNA sequence encoding the HIV-1 Integrase was constructed and used to recombinantly synthesize the protein.
Brand: enQuireBio™ QP12252-500ug
Additional Details : Weight : 0.01000kg
Specifications
HIV-1 Integrase Protein | |
Research Use Only | |
Recombinant Protein | |
E. coli | |
mfldgidkaqeehekyhsnwramasdfnlppvvakeivascdkcqlkgeamhgqvdcspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfilklagrwpvktihtdngsnftsttvkaacwwagikqefgipynpqsqgviesmnkelkkiigqvrdqaehlktavqmavfihnfkrkggiggysagerivdiiatdiqtkelqkqitkiqnfrvyyrdsrdplwkgpakllwkgegavviqdnsdikvvprrkakiirdygkqmagddcvasrqdedhhhhhh | |
Greater than 95.0% as determined by SDS-PAGE. |
500 μg | |
Not Determined. Testing recommended prior to use in cell culture and can be performed upon request. | |
HIV | |
His | |
1.5M urea, 25mM Tris-HCl pH 8.0, 0.2% Triton-X and 50% Glycerol. |