missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant HIV-1 Integrase Protein

A cDNA sequence encoding the HIV-1 Integrase was constructed and used to recombinantly synthesize the protein.

Brand:  enQuireBio™ QP12252-500ug

Additional Details : Weight : 0.01000kg

 View more versions of this product

Product Code. 15939838

  • £583.00 / 500µg

Estimated Shipment
26-04-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

Specifications

Specifications

HIV-1 Integrase Protein
500 μg
Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
HIV
His
1.5M urea, 25mM Tris-HCl pH 8.0, 0.2% Triton-X and 50% Glycerol.
Greater than 95.0% as determined by SDS-PAGE.
Research Use Only
Recombinant Protein
E. coli
mfldgidkaqeehekyhsnwramasdfnlppvvakeivascdkcqlkgeamhgqvdcspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfilklagrwpvktihtdngsnftsttvkaacwwagikqefgipynpqsqgviesmnkelkkiigqvrdqaehlktavqmavfihnfkrkggiggysagerivdiiatdiqtkelqkqitkiqnfrvyyrdsrdplwkgpakllwkgegavviqdnsdikvvprrkakiirdygkqmagddcvasrqdedhhhhhh
Videos
SDS
Documents