enQuireBio™ Recombinant HIV-1 Integrase Protein

A cDNA sequence encoding the HIV-1 Integrase was constructed and used to recombinantly synthesize the protein.

Brand:  enQuireBio™ QP12252-500ug

Product Code. 15939838

Specifications

• Name: HIV-1 Integrase Protein
• Regulatory Status: Research Use Only
• Product Type: Recombinant Protein
• Species: E. coli
• Sequence: mfldgidkaqeehekyhsnwramasdfnlppvvakeivascdkcqlkgeamhgqvdcspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfilklagrwpvktihtdngsnftsttvkaacwwagikqefgipynpqsqgviesmnkelkkiigqvrdqaehlktavqmavfihnfkrkggiggysagerivdiiatdiqtkelqkqitkiqnfrvyyrdsrdplwkgpakllwkgegavviqdnsdikvvprrkakiirdygkqmagddcvasrqdedhhhhhh
• Purity or Quality Grade: Greater than 95.0% as determined by SDS-PAGE.

• Quantity: 500 μg
• Endotoxin Concentration: Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
• Cross Reactivity: HIV
• Protein Tag: His
• Buffer: 1.5M urea, 25mM Tris-HCl pH 8.0, 0.2% Triton-X and 50% Glycerol.