missing translation for 'onlineSavingsMsg'
Learn More
Learn More
RDH5 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£328.00 - £513.00
Specifications
| Antigen | RDH5 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Produktcode | Marke | Quantity | Preis | Menge & Verfügbarkeit | |||||
|---|---|---|---|---|---|---|---|---|---|
| Produktcode | Marke | Quantity | Preis | Menge & Verfügbarkeit | |||||
|
18205833
|
Novus Biologicals
NBP2-56636 |
100 μL |
£513.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18626728
|
Novus Biologicals
NBP2-56636-25ul |
25 μL |
£328.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Beschreibung
RDH5 Polyclonal specifically detects RDH5 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Spezifikation
| RDH5 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| 11-cis RDH, 11-cis retinol dehydrogenase, 9,9-cis-retinol specific dehydrogenase, EC 1.1.1, EC 1.1.1.105, FLJ39337, FLJ97089, HSD17B, RDH1, retinol dehydrogenase 1, retinol dehydrogenase 5 (11-cis and 9-cis), retinol dehydrogenase 5 (11-cis/9-cis), SDR9C5, short chain dehydrogenase/reductase family 9C, member 5 | |
| RDH5 | |
| IgG | |
| Affinity Purified |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 5959 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:NNAGVAGIIGPTPWLTRDDFQRVLNVNTMGPIGVTLALL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts