missing translation for 'onlineSavingsMsg'
Få mere at vide
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. RCSD 1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

RCSD 1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Artikelnummer. 18308166 Shop alle Bio Techne produkter
Skift visning
Klik for at se tilgængelige muligheder
Quantity:
100 μg
25 μg
Pakningsstørrelse:
100µL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Quantity unitSize
18308166 25 μg 25µL
18388193 100 μg 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Denne vare kan ikke returneres. Se returpolicy
Artikelnummer. 18308166 Leverandør Novus Biologicals Leverandørnr. NBP31753325UL

Please to purchase this item. Need a web account? Register with us today!

Denne vare kan ikke returneres. Se returpolicy

Beskrivelse

Rabbit Polyclonal Antibody

RCSD 1 Polyclonal antibody specifically detects RCSD 1 in Human samples. It is validated for Immunofluorescence
TRUSTED_SUSTAINABILITY

Tekniske data

Antigen RCSD 1
Applications Immunofluorescence
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL
Formulation PBS, pH 7.2, 40% glycerol
Gene Alias capZ-interacting protein, CAPZIP, MGC126585, MGC126611, MGC21854, MK2S4, Protein kinase substrate CapZIP, protein kinase substrate MK2S4, RCSD domain containing 1, RCSD domain-containing protein 1
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: MEERPAETNANVDNSASPSVAQLAGRFREQAAAAKETPASKPTRRKPPCSL
Purification Method Affinity purified
Quantity 25 μg
Regulatory Status RUO
Research Discipline Protein Kinase
Primary or Secondary Primary
Gene ID (Entrez) 92241
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Vis mere Vis mindre
Produkttitel
Vælg et problem

Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.