missing translation for 'onlineSavingsMsg'
Learn More
Learn More
RCN2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-32010-25ul
Denna artikel kan inte returneras.
Se returpolicy
Beskrivning
RCN2 Polyclonal specifically detects RCN2 in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Specifikationer
| RCN2 | |
| Polyclonal | |
| Western Blot 0.4 ug/ml, Immunohistochemistry 1:5000 - 1:10000, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:5000 - 1:10000 | |
| Q14257 | |
| RCN2 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: AEELHYPLGERRSDYDREALLGVQEDVDEYVKLGHEEQQKRLQAIIKKIDLDSDGFLTESELSSWIQMSFKHYAMQEAKQQFVEYDK | |
| 25 μL | |
| Core ESC Like Genes, Stem Cell Markers | |
| 5955 | |
| Human, Mouse | |
| IgG |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| Calcium-binding protein ERC-55, E6BPreticulocalbin 2, EF-hand calcium binding domain (endoplasmic reticulumcalcium-binding protein, 55kD), ERC-55, ERC55E6-binding protein, reticulocalbin 2, EF-hand calcium binding domain, reticulocalbin-2, TCBP49 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of human RCN2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Korrigering av produktinnehåll
Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.
Produkttitel
For Research Use Only
Hittar du en möjlighet till förbättring?Dela en innehållskorrigering