missing translation for 'onlineSavingsMsg'
Learn More
Learn More
RCN1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-37987-25ul
This item is not returnable.
View return policy
Description
RCN1 Polyclonal specifically detects RCN1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| RCN1 | |
| Polyclonal | |
| Western Blot 0.4 μg/mL, Immunohistochemistry, Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
| Q15293 | |
| RCN1 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: KPTVRKERVVRPDSELGERPPEDNQSFQYDHEA | |
| 25 μL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles. |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| FLJ37041, FLJ55835, PIG20, proliferation-inducing gene 20, RCAL, RCN, reticulocalbin 1, EF-hand calcium binding domain, reticulocalbin-1 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 5954 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction