RCE1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-59922

Product Code. 18242772

Description

RCE1 Polyclonal specifically detects RCE1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: RCE1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: CAAX prenyl protease 2, EC 3.4.22.-, FACE-2, FACE2RCE1 homolog, prenyl protein protease (S. cerevisiae), farnesylated protein-converting enzyme 2, Farnesylated proteins-converting enzyme 2, hRCE1, Prenyl protein-specific endoprotease 2, RCE1 (S. Cerevisiae) homolog, prenyl protein protease, RCE1 homolog, RCE1 homolog, prenyl protein peptidase (S. cerevisiae), RCE1 homolog, prenyl protein protease, RCE1A, RCE1B
• Host Species: Rabbit
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Gene ID (Entrez): 9986
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Concentration: 1 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
• Gene Accession No.: Q9Y256
• Gene Symbols: RCE1
• Immunogen: Synthetic peptides corresponding to RCE1(RCE1 homolog, prenyl protein peptidase (S. cerevisiae)) The peptide sequence was selected from the N terminal of RCE1. Peptide sequence WARCLTDMRWLRNQVIAPLTEELVFRACMLPMLAPCMGLGPAVFTCPLFF.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Xenopus: 100%; Canine: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Goat: 92%; Zebrafish: 92%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Goat, Rabbit, Zebrafish
• Form: Purified

For Research Use Only