RCBTB1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-58358-25ul

Product Code. 18625348

Description

RCBTB1 Polyclonal specifically detects RCBTB1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: RCBTB1
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 μg/mL
• Gene Alias: Chronic lymphocytic leukemia deletion region gene 7 protein, CLL deletion region gene 7 protein, CLLD7MGC33184, CLLL7, E4.5, FLJ10716, GDP/GTP exchange factor (GEF)-like protein, GLP, RCC1 and BTB domain-containing protein 1, regulator of chromosome condensation (RCC1) and BTB (POZ) domain containingprotein 1, Regulator of chromosome condensation and BTB domain-containing protein 1, RP11-185C18.1
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 55213
• Target Species: Human
• Isotype: IgG

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2), 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: RCBTB1
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:RCEHFRSMFQSYWNEDMKEVIEIDQFSYPVY
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.

For Research Use Only