RCAN3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-84972

Product Code. 18276146

Description

RCAN3 Polyclonal specifically detects RCAN3 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: RCAN3
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Alias: Down syndrome candidate region 1-like 2, Down syndrome critical region gene 1-like 2, DSCR1L2regulator of calcineurin 3 isoform 13,45,MCIP3regulator of calcineurin 3 isoform 1a2,34,5, hRCN3, Myocyte-enriched calcineurin-interacting protein 3, RCAN family member 3, RCN3, Regulator of calcineurin 3, regulator of calcineurin 3 isoform 1a3,45,Down syndrome candidate region 1-like protein 2, regulator of calcineurin 3 isoform 1b2,34,5, regulator of calcineurin 3 isoform 1c2,34,5, regulator of calcineurin 3 isoform 1c3,45,calcipressin-3
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: RCAN3
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:LRDTMKSWNDSQSDLCSTDQEEEEEMIFGENEDDLDEMMDLSDLPTSLFACSVHEAVFEAREQKERFEALFTIYDD
• Quantity: 0.1 mL
• Research Discipline: Neuroscience
• Gene ID (Entrez): 11123
• Target Species: Human
• Isotype: IgG

For Research Use Only