RCAN2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-79477

Product Code. 18277415

Description

RCAN2 Polyclonal specifically detects RCAN2 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: RCAN2
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: Calcipressin 2 (Thyroid hormone-responsive protein ZAKI-4) (Down syndromecandidate region 1-like 1) (Myocyte-enriched calcineurin interacting protein2) (MCIP2), calcipressin-2, Down syndrome candidate region 1-like 1, Down syndrome critical region gene 1-like 1, DSCR1L1MCIP2ZAKI4RCN2, hRCN2, Myocyte-enriched calcineurin-interacting protein 2, regulator of calcineurin 2CSP2, thyroid hormone-responsive (skin fibroblasts), Thyroid hormone-responsive protein ZAKI-4, ZAKI-4
• Host Species: Rabbit
• Molecular Weight of Antigen: 22 kDa
• Quantity: 100 μL
• Research Discipline: Signal Transduction
• Gene ID (Entrez): 10231
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_005813
• Gene Symbols: RCAN2
• Immunogen: Synthetic peptide directed towards the middle region of human RCAN2The immunogen for this antibody is RCAN2. Peptide sequence LHETQFRGKKLKLYFAQVQTPETDGDKLHLAPPQPAKQFLISPPSSPPVG.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Chicken: 85%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG