missing translation for 'onlineSavingsMsg'
Learn More
Learn More
RBPMS Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£362.00
Specifications
| Antigen | RBPMS |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
RBPMS Polyclonal specifically detects RBPMS in Human samples. It is validated for Western Blot.Specifications
| RBPMS | |
| Polyclonal | |
| Rabbit | |
| DNA Repair, Mismatch Repair | |
| FLJ32971, Heart and RRM expressed sequence, Hermes, HERMESRNA-binding protein with multiple splicing, RBP-MS, RNA binding protein with multiple splicing | |
| RBPMS | |
| IgG | |
| 22 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q93062 | |
| 11030 | |
| Synthetic peptide directed towards the N terminal of human RBPMS (NP_001008710). Peptide sequence RELYLLFRPFKGYEGSLIKLTSKQPVGFVSFDSRSEAEAAKNALNGIRFD. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title