missing translation for 'onlineSavingsMsg'
Learn More

RBMY1F Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

£328.00 - £513.00

Specifications

Antigen	RBMY1F
Dilution	Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50
Applications	Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification	Polyclonal
Conjugate	Unconjugated

View More Specs

Products 2

Product Code	Brand	Quantity	Price	Quantity & Availability
Product Code	Brand	Quantity	Price	Quantity & Availability
18667065 View Documents missing translation for 'viewProductCertificates'	Novus Biologicals NBP2-46812-25ul	25 μL	£328.00 25µL View alternative products Save Up to »		Please sign in to purchase this item. Need a web account? Register with us today!

18638665 View Documents missing translation for 'viewProductCertificates'	Novus Biologicals NBP2-46812	0.1 mL	£513.00 0.10mL View alternative products Save Up to »		Please sign in to purchase this item. Need a web account? Register with us today!

Description

RBMY1F Polyclonal antibody specifically detects RBMY1F in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

Antigen	RBMY1F
Applications	Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate	Unconjugated
Host Species	Rabbit
Research Discipline	Cell Biology, Stem Cells
Formulation	PBS (pH 7.2), 40% Glycerol
Gene Alias	MGC33094, RNA binding motif protein, Y-linked, family 1, member F, RNA-binding motif protein, Y chromosome, family 1 member F/J, Y chromosome RNA recognition motif 2, YRRM2
Immunogen	This antibody was developed against Recombinant Protein corresponding to amino acids: GGSTCHAYSNTRDRYGRSWESYSSCGDFHYCDREHVCRKDQRNPPSLGRVLPDPREA
Primary or Secondary	Primary
Content And Storage	Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Dilution	Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50
Classification	Polyclonal
Form	Purified
Regulatory Status	RUO
Target Species	Human
Gene Accession No.	Q15415
Gene ID (Entrez)	159163
Isotype	IgG
Purification Method	Immunogen affinity purified

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.

RBMY1F Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents