missing translation for 'onlineSavingsMsg'
Learn More
Learn More
RBMS3 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
£157.00 - £364.00
Specifications
| Antigen | RBMS3 |
|---|---|
| Dilution | Western Blot 1:500-1:2000 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
RBMS3 Polyclonal antibody specifically detects RBMS3 in Mouse samples. It is validated for Western BlotSpecifications
| RBMS3 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Mouse | |
| RNA binding motif, single stranded interacting protein 3, RNA-binding protein, single stranded interacting protein, single-stranded-interacting protein 3 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 334-433 of human RBMS3 (NP_001171183.1). MDHPMSMQPANMMGPLTQQMNHLSLGTTGTYMTAAAPMQGTYIPQYTPVPPTAVSIEGVVADTSPQTVAPSSQDTSGQQQQIAVDTSNEHAPAYSYQQSK | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
| Western Blot 1:500-1:2000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS (pH 7.3), 50% glycerol | |
| 27303 | |
| IgG | |
| Affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title