missing translation for 'onlineSavingsMsg'
Learn More
Learn More
RBMS2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | RBMS2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
RBMS2 Polyclonal specifically detects RBMS2 in Human samples. It is validated for Western Blot.Specifications
| RBMS2 | |
| Polyclonal | |
| Rabbit | |
| Q15434 | |
| 5939 | |
| Synthetic peptides corresponding to RBMS2(RNA binding motif, single stranded interacting protein 2) The peptide sequence was selected from the N terminal of RBMS2. Peptide sequence MLLSVTSRPGISTFGYNRNNKKPYVSLAQQMAPPSPSNSTPNSSSGSNGN. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| FLJ39093, FLJ40023, RNA binding motif, single stranded interacting protein 2, RNA-binding motif, single-stranded-interacting protein 2, SCR3FLJ43262, Suppressor of CDC2 with RNA-binding motif 3 | |
| RBMS2 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title