missing translation for 'onlineSavingsMsg'
Learn More
Learn More
RBMS1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£378.00
Specifications
| Antigen | RBMS1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Form | Purified |
Description
RBMS1 Polyclonal specifically detects RBMS1 in Human samples. It is validated for Western Blot.Specifications
| RBMS1 | |
| Polyclonal | |
| Purified | |
| RUO | |
| chromosome 2 open reading frame 12, DKFZp564H0764, HCC-4, MGC15146, MGC3331, MGC97258, MGC97270, MGC97282, MGC99543, MSSP1, MSSP-1, MSSP-2, MSSP-3, RNA binding motif, single stranded interacting protein 1, SCR2MGC70597, single-stranded-interacting protein 1, suppressor of cdc 2 (cdc13) with RNA binding motif 2 | |
| RBMS1 | |
| IgG | |
| Protein A purified |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| P29558-2 | |
| 5937 | |
| Synthetic peptides corresponding to RBMS1 (RNA binding motif, single stranded interacting protein 1) The peptide sequence was selected from the middle region of RBMS1. Peptide sequence GVSAPTEPLLCKFADGGQKKRQNPNKYIPNGRPWHREGEAGMTLTYDPTT. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title