RBM4B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Product Code	Brand	Quantity
18277195	Novus Biologicals NBP1-80469	100 μL

Description

RBM4B Polyclonal specifically detects RBM4B in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: RBM4B
• Classification: Polyclonal
• Form: Purified
• Regulatory Status: RUO
• Gene Alias: MGC10871, RBM30, RBM4L, RNA binding motif protein 30, RNA binding motif protein 4B, RNA-binding motif protein 30, RNA-binding motif protein 4B, RNA-binding protein 30, RNA-binding protein 4B, ZCCHC15, ZCRB3B, zinc finger CCHC-type and RNA binding motif 3B
• Gene Symbols: RBM4B
• Isotype: IgG
• Purification Method: Protein A purified

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Host Species: Rabbit
• Gene Accession No.: NP_113680
• Gene ID (Entrez): 83759
• Immunogen: Synthetic peptide directed towards the C terminal of human RBM4B. Peptide sequence AAAATTSSYYGRDRSPLRRAAAMLPTVGEGYGYGPESELSQASAATRNSL.
• Primary or Secondary: Primary