missing translation for 'onlineSavingsMsg'
Learn More
Learn More
RBM26 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£145.00 - £417.00
Specifications
| Antigen | RBM26 |
|---|---|
| Dilution | Western Blot 1:500 - 1:2000, ELISA |
| Applications | ELISA, Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
30231144
|
Novus Biologicals
NBP3-35313-100ul |
100 μL |
£417.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
30232057
|
Novus Biologicals
NBP3-35313-20ul |
20 μL |
£145.00
20µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
RBM26 Polyclonal antibody specifically detects RBM26 in Mouse,Rat samples. It is validated for ELISA,Western BlotSpecifications
| RBM26 | |
| ELISA, Western Blot | |
| Unconjugated | |
| Rabbit | |
| Cell Biology | |
| PBS (pH 7.3), 50% glycerol | |
| 64062 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500 - 1:2000, ELISA | |
| Polyclonal | |
| Purified | |
| RUO | |
| Mouse, Rat | |
| acidic rich RS domain containing 2, ARRS2, C13orf10, chromosome 13 open reading frame 10, CTCL tumor antigen se70-2, cutaneous T-cell lymphoma tumor antigen se70-2, FLJ20957, MGC133295, MGC133296, PRO1777, RNA binding motif protein 26, RNA-binding motif protein 26, RNA-binding protein 26, RP11-255E21.1, SE70-2, ZC3H17 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 65-140 of human RBM26 (NP_071401.3).,, Sequence:, TQIFVEKLFDAVNTKSYLPPPEQPSSGSLKVEFFPHQEKDIKKEEITKEEEREKKFSRRLNHSPPQSSSRYRENRS | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title