missing translation for 'onlineSavingsMsg'
Learn More
Learn More
RBM26 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-94368-0.1ml
This item is not returnable.
View return policy
Description
RBM26 Polyclonal antibody specifically detects RBM26 in Human samples. It is validated for Western Blot
Specifications
| RBM26 | |
| Polyclonal | |
| Western Blot 1:1000-1:2000 | |
| acidic rich RS domain containing 2, ARRS2, C13orf10, chromosome 13 open reading frame 10, CTCL tumor antigen se70-2, cutaneous T-cell lymphoma tumor antigen se70-2, FLJ20957, MGC133295, MGC133296, PRO1777, RNA binding motif protein 26, RNA-binding motif protein 26, RNA-binding protein 26, RP11-255E21.1, SE70-2, ZC3H17 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 65-140 of human RBM26 (NP_071401.3). TQIFVEKLFDAVNTKSYLPPPEQPSSGSLKVEFFPHQEKDIKKEEITKEEEREKKFSRRLNHSPPQSSSRYRENRS | |
| 0.1 mL | |
| Cell Biology | |
| 64062 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction