RBM24 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-57328-25ul

Product Code. 18648087

Description

RBM24 Polyclonal specifically detects RBM24 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: RBM24
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 μg/mL
• Gene Alias: dJ259A10.1, FLJ26355, FLJ30829, FLJ37697, RNA binding motif protein 24, RNA-binding motif protein 24, RNA-binding protein 24, RNA-binding region (RNP1, RRM) containing 6, RNA-binding region-containing protein 6, RNPC6
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 221662
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: RBM24
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PALIQRPFGIPAHYVYPQAFVQPGVVIPHVQPTA
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Isotype: IgG

For Research Use Only