missing translation for 'onlineSavingsMsg'
Learn More
Learn More
RBM18 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | RBM18 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
RBM18 Polyclonal specifically detects RBM18 in Human samples. It is validated for Western Blot.Specifications
| RBM18 | |
| Polyclonal | |
| Rabbit | |
| NP_149108 | |
| 92400 | |
| Synthetic peptide directed towards the middle region of human RBM18. Peptide sequence VRWAHAQVKRYDHNKNDKILPISLEPSSSTEPTQSNLSVTAKIKAIEAKL. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| MGC2734, RNA binding motif protein 18, RNA-binding motif protein 18 | |
| RBM18 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title