RBM17 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-38348

Product Code. 18128897

Description

RBM17 Polyclonal specifically detects RBM17 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: RBM17
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Accession No.: Q96I25
• Gene Symbols: RBM17
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: SQRTKQSTVLAPVIDLKRGGSSDDRQIVDTPPHVAAGLKDPVPSGFSAGEVLIPLADEYDPMFPNDYEKVV
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: MGC14439, RNA binding motif protein 17, RNA-binding motif protein 17, SPF45DKFZp686F13131, splicing factor 45,45 kDa-splicing factor, splicing factor 45kDa
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 84991
• Target Species: Human
• Isotype: IgG