missing translation for 'onlineSavingsMsg'
Learn More
Learn More
RBM11 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | RBM11 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
RBM11 Polyclonal specifically detects RBM11 in Human samples. It is validated for Western Blot.Specifications
| RBM11 | |
| Polyclonal | |
| Rabbit | |
| putative gene, RNA binding motif protein 11 like10putative RNA-binding protein 11, RNA binding motif protein 11, RNA-binding motif protein 11 | |
| RBM11 | |
| IgG |
| Western Blot | |
| Unconjugated | |
| RUO | |
| 54033 | |
| Synthetic peptides corresponding to RBM11 (RNA binding motif protein 11) The peptide sequence was selected from the middle region of RBM11. Peptide sequence SLNHVPDLEAGPSSYKWTHQQPSDSDLYQMNKRKRQKQTSDSDSSTDNNR. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title