missing translation for 'onlineSavingsMsg'
Learn More
Learn More
RBM10 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
£258.00 - £435.00
Specifications
| Antigen | RBM10 |
|---|---|
| Dilution | Western Blot 0.4 ug/ml, Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200-1:500, Knockdown Validated |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18459450
|
Novus Biologicals
NBP1-84951-25ul |
25ul |
£258.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18266027
|
Novus Biologicals
NBP1-84951 |
0.1 mL |
£435.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
RBM10 Polyclonal specifically detects RBM10 in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated.Specifications
| RBM10 | |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 8241 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:MEYERRGGRGDRTGRYGATDRSQDDGGENRSRDHDYRDMDYRSYPREYGSQEGKHDYDDSSEEQSAEDSYEASPGSETQRR | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot 0.4 ug/ml, Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200-1:500, Knockdown Validated | |
| Polyclonal | |
| Rabbit | |
| Human, Mouse | |
| DXS8237ERNA-binding motif protein 10, G patch domain-containing protein 9, GPATC9TARPS, GPATCH9MGC1132, KIAA0122RNA-binding protein S1-1, MGC997, RNA binding motif protein 10, RNA-binding protein 10, S1-1, ZRANB5 | |
| RBM10 | |
| IgG | |
| Affinity Purified | |
| Specificity of human RBM10 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title