missing translation for 'onlineSavingsMsg'
Learn More
Learn More
RBBP6 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-58777
This item is not returnable.
View return policy
Description
RBBP6 Polyclonal specifically detects RBBP6 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
Specifications
| RBBP6 | |
| Polyclonal | |
| Immunocytochemistry/Immunofluorescence 1-4 ug/ml | |
| E3 ubiquitin-protein ligase RBBP6, EC 6.3.2.-, MY038, P2PR, P2P-R, p53-associated cellular protein of testis, PACTDKFZp761B2423, Proliferation potential-related protein, Protein P2P-R, RB-binding Q-protein 1, RBQ1, RBQ-1, retinoblastoma binding protein 6, Retinoblastoma-binding protein 6DKFZp686P0638, Retinoblastoma-binding Q protein 1, SNAMA | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| RBBP6 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:TMEEYNNDNTAPAEDVIIMIQVPQSKWDKDDFESEEEDVKSTQPISSVGKPASVIKNVSTKPSNIVKYPEKESEPSEKIQKFTKDVSHE | |
| 100 μL | |
| Tumor Suppressors | |
| 5930 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction