missing translation for 'onlineSavingsMsg'
Learn More
Learn More
RBBP4/RbAp48 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£292.00 - £488.00
Specifications
| Antigen | RBBP4/RbAp48 |
|---|---|
| Dilution | Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Applications | Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18640766
|
Novus Biologicals
NBP2-46858-25ul |
25 μL |
£292.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18639265
|
Novus Biologicals
NBP2-46858 |
0.1 mL |
£488.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
RBBP4/RbAp48 Polyclonal antibody specifically detects RBBP4/RbAp48 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)Specifications
| RBBP4/RbAp48 | |
| Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Cell Cycle and Replication | |
| PBS (pH 7.2), 40% Glycerol | |
| 5928 | |
| IgG | |
| Immunogen affinity purified |
| Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| CAF-1 subunit C, CAF-I p48, Chromatin assembly factor 1 subunit C, Chromatin assembly factor I p48 subunit, chromatin assembly factor/CAF-1 p48 subunit, histone-binding protein RBBP4, MSI1 protein homolog, Nucleosome-remodeling factor subunit RBAP48, NURF55, RbAp48, RBBP-4, retinoblastoma binding protein 4, Retinoblastoma-binding protein 4CAF-I 48 kDa subunit, Retinoblastoma-binding protein p48 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: QWSPHNETILASSGTDRRLNVWDLSKIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMA | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title