Invitrogen™ RbAp48 Polyclonal Antibody

Rabbit Polyclonal Antibody

Brand:  Invitrogen™ PA595325

Product Code. 16324595

Description

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human Hela whole cell, human Raji whole cell, human Jurkat whole cell, human U87 whole cell, human HepG2 whole cell, human K562 whole cell, human RT4 whole cell, human A549 whole cell, rat brain tissue, rat liver tissue, rat lung tissue, rat RH35 whole cell, mouse brain tissue, mouse liver tissue, mouse lung tissue, mouse HEPA1-6 whole cell, rat brain tissue, rat liver tissue, rat lung tissue, rat RH35 whole cell, mouse brain tissue, mouse liver tissue, mouse liver tissue, mouse lung tissue, mouse HEPA1-6 whole cell. IHC: Human Intestinal Cancer tissue, Mouse Liver tissue, Rat Intestine tissue IHC-F: mouse small intestine tissue, rat small intestine tissue, mouse liver tissue, human placenta tissue. ICC/IF: U2OS cell, A431 cell. Flow: 293T cell. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

RbAp48-11G10 recognizes full length RbAp48, a 48 kDa nuclear protein first isolated by its ability to interact with the carboxyl-terminus of the retinoblastoma protein (Rb). It is a member of the WD (Trp-Asp) repeat family of proteins. RbAp48 is one of the three subunits of CAF-1, can bind to histone H4 and is a subunit of human histone deacetylase HD1.

Specifications

• Antigen: RbAp48
• Classification: Polyclonal
• Conjugate: Unconjugated
• Gene: RBBP4
• Gene Alias: CAF-1 p48 subunit; CAF-1 subunit C; CAF-I 48 kDa subunit; CAF-I p48; chromatin assembly factor 1 subunit C; Chromatin assembly factor I p48 subunit; chromatin assembly factor/CAF-1 p48 subunit; histone-binding protein RBBP4; lin-53; mRbAp48; MSI1 protein homolog; nucleosome-remodeling factor subunit RBAP48; NURF55; RB binding protein 4, chromatin remodeling factor; RBAP48; RBBP4; RBBP-4; retinoblastoma binding protein 4; retinoblastoma-binding protein 4; Retinoblastoma-binding protein p48
• Host Species: Rabbit
• Purification Method: Affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 19646, 313048, 5928
• Content And Storage: -20°C
• Form: Lyophilized

• Applications: Flow Cytometry, Immunohistochemistry (Frozen), Immunohistochemistry (Paraffin), Western Blot, Immunocytochemistry
• Concentration: 500 μg/mL
• Formulation: PBS with 5mg BSA and 0.05mg sodium azide
• Gene Accession No.: Q09028, Q60972
• Gene Symbols: RBBP4
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human RbAp48 (395-425aa EDNIMQVWQMAENIYNDEDPEGSVDPEGQGS).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Product Type: Antibody
• Isotype: IgG