RASSF7 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-58860

Product Code. 18240623

Description

RASSF7 Polyclonal specifically detects RASSF7 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: RASSF7
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
• Gene Alias: chromosome 11 open reading frame 13, HRAS1-related cluster protein 1, HRAS1-related cluster-1, HRC1C11orf13HRAS1, MGC126069, MGC126070, Ras association (RalGDS/AF-6) domain family (N-terminal) member 7, Ras association (RalGDS/AF-6) domain family 7, ras association domain-containing protein 7
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 8045
• Target Species: Human
• Isotype: IgG

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: RASSF7
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:QATCGQFASDVQFVLRRTGPSLAGRPSSDSCPPPERCLIRASLPVKPRAALGCEPRKTLTPEPAPSLSRPGP
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only