missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Ras-GAP Antibody, Novus Biologicals™
Rabbit Monoclonal Antibody
Brand: Novus Biologicals NBP3-33535-20ul
This item is not returnable.
View return policy
Description
Ras-GAP Monoclonal antibody specifically detects Ras-GAP in Human,Mouse samples. It is validated for ELISA,Western Blot
Specifications
| Ras-GAP | |
| Monoclonal | |
| Western Blot 1:100 - 1:500, ELISA Recommended starting concentration is 1 μg/mL | |
| CMAVM;CM-AVM;CMAVM1;GAP;p120;p120GAP;p120RASGAP;PKWS;Ras GTPase-activating protein 1;RASA;RASA1;RASGAP | |
| A synthetic peptide corresponding to a sequence within amino acids 200-300 of human Ras-GAP (P20936).,, Sequence:, KSGSYLIRESDRRPGSFVLSFLSQMNVVNHFRIIAMCGDYYIGGRRFSSLSDLIGYYSHVSCLLKGEKLLYPVAPPEPVEDRRRVRAILPYTKVPDTDEIS | |
| 20 μL | |
| Cancer, Core ESC Like Genes, Neuronal Cell Markers, Neuroscience, Phospho Specific, Signal Transduction, Stem Cell Markers | |
| 5921 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| ELISA, Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol, 0.05% BSA | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction