missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
RAP74 Polyclonal antibody specifically detects RAP74 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
Specifications
| Antigen | RAP74 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Formulation | PBS (pH 7.2) and 40% Glycerol |
| Gene Alias | BTF4, General transcription factor IIF 74 kDa subunit, general transcription factor IIF subunit 1, general transcription factor IIF, polypeptide 1, 74kDa, TF2F1, TFIIF, TFIIF-alpha, Transcription initiation factor IIF subunit alpha, transcription initiation factor RAP74 |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: SLSGKSTPQPPSGKTTPNSGDVQVTEDAVRRYLTRKPMTTKDLLKKFQTKKTGLSSEQTVNVLAQILKRLNP |
| Purification Method | Protein A purified |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?