missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
RAP30 Polyclonal antibody specifically detects RAP30 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
Specifications
| Antigen | RAP30 |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1.0 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin |
| Formulation | PBS, 2% Sucrose |
| Gene Alias | ATP-dependent helicase GTF2F2, BTF4, General transcription factor IIF 30 kDa subunit, general transcription factor IIF subunit 2, general transcription factor IIF, polypeptide 2, 30kDa, TF2F2, TFIIF, TFIIF-beta, Transcription initiation factor IIF subunit beta, Transcription initiation factor RAP30 |
| Host Species | Rabbit |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of human RAP30. Peptide sequence: KDLVDITKQPVVYLKEILKEIGVQNVKGIHKNTWELKPEYRHYQGEEKSD The peptide sequence for this immunogen was taken from within the described region. |
| Purification Method | Immunogen affinity purified |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?