missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18365916

RAP30 Antibody, Novus Biologicals™

Product Code. 18365916 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
Unit Size:
0.1mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18365916 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18365916 Supplier Novus Biologicals Supplier No. NBP317978

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

RAP30 Polyclonal antibody specifically detects RAP30 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Specifications

Antigen RAP30
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin
Formulation PBS, 2% Sucrose
Gene Alias ATP-dependent helicase GTF2F2, BTF4, General transcription factor IIF 30 kDa subunit, general transcription factor IIF subunit 2, general transcription factor IIF, polypeptide 2, 30kDa, TF2F2, TFIIF, TFIIF-beta, Transcription initiation factor IIF subunit beta, Transcription initiation factor RAP30
Host Species Rabbit
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of human RAP30. Peptide sequence: KDLVDITKQPVVYLKEILKEIGVQNVKGIHKNTWELKPEYRHYQGEEKSD The peptide sequence for this immunogen was taken from within the described region.
Purification Method Immunogen affinity purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline Chromatin Research
Primary or Secondary Primary
Gene ID (Entrez) 2963
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Form Purified
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.