missing translation for 'onlineSavingsMsg'
Learn More
Learn More
RALGPS1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | RALGPS1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
RALGPS1 Polyclonal specifically detects RALGPS1 in Human samples. It is validated for Western Blot.Specifications
| RALGPS1 | |
| Polyclonal | |
| Rabbit | |
| Signal Transduction | |
| KIAA0351RalGEF 2, Ral GEF with PH domain and SH3 binding motif 1, Ral GEF with PH domain and SH3-binding motif 1, Ral guanine nucleotide exchange factor 2, Ral guanine nucleotide exchange factor RalGPS1A, RalA exchange factor RalGPS1, RALGEF2RALGPS1A, ras-specific guanine nucleotide-releasing factor RalGPS1 | |
| RALGPS1 | |
| IgG |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q5JS13 | |
| 9649 | |
| Synthetic peptides corresponding to RALGPS1(Ral GEF with PH domain and SH3 binding motif 1) The peptide sequence was selected from the middle region of RALGPS1. Peptide sequence AGSLPTPPVPRHRKSHSLGNNMMCQLSVVESKSATFPSEKARHLLDDSVL. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title