RALGDS Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-56832

Product Code. 18258402

Description

RALGDS Polyclonal specifically detects RALGDS in Human samples. It is validated for Western Blot.

Specifications

• Antigen: RALGDS
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: ral guanine nucleotide dissociation stimulator, Ral guanine nucleotide exchange factor, RalGDS, RalGEFKIAA1308, RGDS, RGFFLJ20922
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Canine: 100%; Human: 100%; Bovine: 92%; Mouse: 92%; Rat: 92%; Guinea pig: 85%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Guinea Pig
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q6KH11
• Gene Symbols: RALGDS
• Immunogen: Synthetic peptides corresponding to RALGDS(ral guanine nucleotide dissociation stimulator) The peptide sequence was selected from the N terminal of RALGDS. Peptide sequence KRYGRCDALTASSRYGCILPYSDEDGGPQDQLKNAISSILGTWLDQYSED.
• Quantity: 100 μL
• Research Discipline: Signal Transduction
• Gene ID (Entrez): 5900
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

For Research Use Only