missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. RALGAPA2 Antibody, Novus Biologicals™

RALGAPA2 Antibody, Novus Biologicals™

Product Code. 18432772 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
25 μL
Unit Size:
0.1mL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18432772 25 μL 25µL
18181024 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18432772 Supplier Novus Biologicals Supplier No. NBP23339925ul

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

RALGAPA2 Polyclonal specifically detects RALGAPA2 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Specifications

Antigen RALGAPA2
Applications Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Accession No. Q2PPJ7
Gene Alias AS250KIAA1272akt substrate AS250, bA287B20.1, C20orf74, chromosome 20 open reading frame 74, dJ1049G11,250 kDa substrate of Akt, dJ1049G11.4, EC 2.7.2.11, EC 5.3.4.1, FLJ12819, p220, Ral GTPase activating protein, alpha subunit 2 (catalytic), ral GTPase-activating protein alpha subunit 2, ral GTPase-activating protein subunit alpha-2, RapGAPalpha2
Gene Symbols RALGAPA2
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: SPAELDLKDDLQQTQGKCRERQKSESTNSDTTLGCTNEAELSMGPWQTCEEDPELNTPTDVVADADARHWLQLSPTDA
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 57186
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.