missing translation for 'onlineSavingsMsg'
Learn More
Learn More
RalA/RalB Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | RalA/RalB |
|---|---|
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Regulatory Status | RUO |
Description
RalA/RalB Polyclonal specifically detects RalA/RalB in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| RalA/RalB | |
| Unconjugated | |
| RUO | |
| NP_005393 | |
| 5898 | |
| Synthetic peptide directed towards the middle region of human RALAThe immunogen for this antibody is RALA. Peptide sequence GQEDYAAIRDNYFRSGEGFLCVFSITEMESFAATADFREQILRVKEDENV. | |
| Primary |
| Polyclonal | |
| Rabbit | |
| Signal Transduction | |
| MGC48949, RAL, Ras family small GTP binding protein RALA, RAS-like protein A, ras-related protein Ral-A, v-ral simian leukemia viral oncogene homolog A (ras related) | |
| RALA | |
| IgG | |
| 23 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title