RAGEF2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Product Code	Brand	Quantity
18433071	Novus Biologicals NBP1-87301-25ul	25 μL
18290508	Novus Biologicals NBP1-87301	0.1 mL

Description

RAGEF2 Polyclonal specifically detects RAGEF2 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: RAGEF2
• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Target Species: Human
• Gene Alias: DKFZp667N084, DKFZp686I15116, KIA001LB, PDZ domain-containing guanine nucleotide exchange factor 2, PDZ domain-containing guanine nucleotide exchange factor I, PDZ-GEF2RA-GEF-2PDZGEF2PDZ domain containing guanine nucleotide exchange factor (GEF) 2, RAGEF2, Rap guanine nucleotide exchange factor (GEF) 6, rap guanine nucleotide exchange factor 6
• Gene Symbols: RAPGEF6
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

• Dilution: Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
• Classification: Polyclonal
• Host Species: Rabbit
• Research Discipline: Signal Transduction
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 51735
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:SNCSVDSMSAALQDERCSSQALAVPESTGALEKTEHASGIGDHSQHGPGWTLLKPSLIKCLAVSSSVSNEEISQEHIIIEAADS
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only