missing translation for 'onlineSavingsMsg'
Learn More
Learn More
RAGEF2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-35727-100ul
This item is not returnable.
View return policy
Description
RAGEF2 Polyclonal antibody specifically detects RAGEF2 in Mouse,Rat samples. It is validated for ELISA,Western Blot
Specifications
| RAGEF2 | |
| Polyclonal | |
| Western Blot 1:500 - 1:2000, ELISA | |
| DKFZp667N084, DKFZp686I15116, KIA001LB, PDZ domain-containing guanine nucleotide exchange factor 2, PDZ domain-containing guanine nucleotide exchange factor I, PDZ-GEF2RA-GEF-2PDZGEF2PDZ domain containing guanine nucleotide exchange factor (GEF) 2, RAGEF2, Rap guanine nucleotide exchange factor (GEF) 6, rap guanine nucleotide exchange factor 6 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 145-240 of human RAGEF2 (NP_001157858).,, Sequence:, INYKGERQTITDDVEVNSYLSLPADLTKMHLTENPHPQVTHVSSSQSGCSIASDSGSSSLSDIYQATESEVGDVDLTRLPEGPVDSEDDEEEDEEI | |
| 100 μL | |
| Signal Transduction | |
| 51735 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| ELISA, Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction