missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ RAGE Monoclonal Antibody (5C6C1)
GREENER_CHOICE

Mouse Monoclonal Antibody

Brand:  Invitrogen™ MA549253

Product Code. 17931501

  • £362.00 / 100µg

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Description

Adding 0.2 mL of distilled water will yield a concentration of 500 μg/mL. Immunogen sequence is different from the related mouse and rat sequences by six amino acids. Positive Control - WB: rat lung tissue, mouse lung tissue. IHC: mouse lung tissue, rat lung tissue, rat lung tissue. Flow: Jurkat cell. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

The Receptor for Advanced Glycation End-products (RAGE) is a gene located on human chromosome 6p21.3, encoding a transmembrane receptor belonging to the immunoglobulin superfamily. RAGE is expressed in various tissues, with significant levels in the lungs, and plays a crucial role in cellular signaling and inflammation. As a receptor, RAGE binds multiple ligands, including advanced glycation end-products (AGEs), amyloid-β peptide, high mobility group box 1 (HMGB1), and S100/calgranulin proteins, facilitating diverse pathological processes like inflammation, cancer progression, and neurodegeneration. The interaction between RAGE and its ligands triggers intracellular signaling pathways such as NF-?B activation, leading to inflammatory responses and oxidative stress. In the context of chronic diseases like diabetes, Alzheimer's, and cardiovascular diseases, RAGE is a critical mediator, linking metabolic disturbance to cellular dysfunction. Therapeutic targeting of RAGE signaling is under investigation, aiming to mitigate its contribution to inflammatory and degenerative diseases.
TRUSTED_SUSTAINABILITY
Specifications

Specifications

RAGE
Monoclonal
500 μg/mL
PBS with 4mg trehalose and no preservative
Q15109, Q62151, Q63495
AGER
A synthetic peptide corresponding to a sequence at the N-terminus of human RAGE (91-120aa IQDEGIFRCQAMNRNGKETKSNYRVRVYQI).
100 μg
Primary
Human, Mouse, Rat
Antibody
IgG2b
Flow Cytometry, Immunohistochemistry (Paraffin), Western Blot
5C6C1
Unconjugated
AGER
advanced glycation end product receptor; advanced glycation end-product receptor; advanced glycation end-products receptor; advanced glycosylation end product-specific receptor; advanced glycosylation end product-specific receptor variant 2; advanced glycosylation end product-specific receptor variant 3; advanced glycosylation end product-specific receptor variant 4; advanced glycosylation end product-specific receptor variant 5; advanced glycosylation end-product specific receptor; Ager; MAPK/MAK/MRK overlapping kinase; MOK; MOK protein kinase; RAGE; RAGE isoform NtRAGE-delta; RAGE isoform sRAGE-delta; RAGE/AGER; RAGE1; RAGE-1; RAGE-4 ORF3; receptor for advanced glycation endproducts; receptor for advanced glycation end-products variant 20; receptor for advanced glycosylation end products; receptor of advanced glycosylation end products of proteins; immunoglobulin superfamily; MHC class II; MHC class III; renal cell carcinoma antigen; renal tumor antigen 1; SCARJ1; sRAGE; STK30
Mouse
Antigen affinity chromatography
RUO
11596, 177, 81722
-20°C
Lyophilized
Product Suggestions

Product Suggestions

Videos
SDS
Documents

Documents

Certificates
Promotions

Promotions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.