missing translation for 'onlineSavingsMsg'
Learn More

RACK1/GNB2L1 Antibody, Novus Biologicals™

Product Code. 18410641 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
Unit Size:
0.1mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18410641 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18410641 Supplier Novus Biologicals Supplier No. NBP183356

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

RACK1/GNB2L1 Polyclonal antibody specifically detects RACK1/GNB2L1 in Human, Mouse samples. It is validated for Western Blot, Immunocytochemistry/ Immunofluorescence
TRUSTED_SUSTAINABILITY

Specifications

Antigen RACK1/GNB2L1
Applications Western Blot, Immunocytochemistry
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.04 to 0.4 μg/mL, Immunocytochemistry/ Immunofluorescence 0.25 to 2 μg/mL
Formulation PBS (pH 7.2) and 40% Glycerol
Gene Accession No. P63244
Gene Alias guanine nucleotide binding, guanine nucleotide binding protein (G protein), beta polypeptide 2-like 1, Receptor for activated C kinase, Receptor for Activated C Kinase 1
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:CVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKTNHIGHTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDG
Purification Method Immunogen affinity purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline Stem Cell Markers
Primary or Secondary Primary
Gene ID (Entrez) 10399
Target Species Human, Mouse
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.