missing translation for 'onlineSavingsMsg'
Learn More

Novus Biologicals™ RABL2A Recombinant Protein Antigen

Product Code. 18174679 Shop All Bio Techne Products
Click to view available options
Protein Length:
DKTKPSELDQGKYDADDNVKIICLGDSAVGKSKLMERFLMDGFQPQQLSTYALTLYKHTATV
KLFNDAIRLAVSYKQNSQDFMDEIFQELENFSLEQEEEDVPDQEQSSSIETPS
Unit Size:
0.10mL
0.1mL
This item is not returnable. View return policy

Product Code. 18174679

Brand: Novus Biologicals™ NBP246696PEP

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human RABL2A The RABL2A Recombinant Protein Antigen is derived from E. coli. The RABL2A Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
TRUSTED_SUSTAINABILITY

Specifications

Protein Length DKTKPSELDQGKYDADDNVKIICLGDSAVGKSKLMERFLMDGFQPQQLSTYALTLYKHTATV
Purity >80% by SDS-PAGE and Coomassie blue staining
Common Name RABL2A Recombinant Protein Antigen
Content And Storage Store at −20°C. Avoid freeze-thaw cycles.
Formulation PBS and 1M Urea, pH 7.4
For Use With (Application) AC
Gene Alias FLJ78724, MGC117180
Gene Symbol RABL2A
Label Type Unlabeled
Product Type Recombinant Protein Antigen
Quantity 0.1 mL
Regulatory Status RUO
Source E.coli
Specific Reactivity Human
Show More Show Less

For Research Use Only.

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.