RABGAP1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-57293

Product Code. 18290325

Description

RABGAP1 Polyclonal specifically detects RABGAP1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: RABGAP1
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
• Gene Alias: DKFZp586D2123, GAP and centrosome-associated protein, GAPCENA, RAB GTPase activating protein 1, rab GTPase-activating protein 1, rab6 GTPase activating protein (GAP and centrosome-associated), Rab6 GTPase activating protein, GAPCenA, Rab6 GTPase-activating protein GAPCenA, RP11-123N4.2, TBC1 domain family, member 11, TBC1D11
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: RABGAP1
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PLSNQLSASSTINPVPLVGLQKPEMSLPVKPGQGDSEASSPFTPVADEDSVVFSKLTYLGCASVNAPRSEVEALRMMSILRSQCQIS
• Quantity: 100 μL
• Research Discipline: Cell Cycle and Replication
• Gene ID (Entrez): 23637
• Target Species: Human
• Isotype: IgG

For Research Use Only