YOD1 Rabbit anti-Human, Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against recombinant YOD1.

Brand:  Abnova PAB22141.100uL

Product Code. 16194900

Description

Deubiquitinating enzymes (DUBs; see MIM 603478) are proteases that specifically cleave ubiquitin (MIM 191339) linkages, negating the action of ubiquitin ligases. DUBA8 belongs to a DUB subfamily characterized by an ovarian tumor (OTU) domain.[supplied by OMIM

Sequence: DMLIIEEDQTRPRSSPAFTKRGASSYVRETLPVLTRTVVPADNSCLFTSVYYVVEGGVLNPACAPEMRRLIAQIVA

Specifications

• Antigen: YOD1
• Classification: Polyclonal
• Description: Rabbit polyclonal antibody raised against recombinant YOD1.
• Formulation: In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
• Gene Alias: DKFZp451J1719/DUBA8/OTUD2/PRO0907
• Host Species: Rabbit
• Purification Method: Antigen affinity purification
• Regulatory Status: RUO
• Gene ID (Entrez): 55432
• Content And Storage: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG

• Applications: Immunohistochemistry (PFA fixed)
• Conjugate: Unconjugated
• Dilution: Immunohistochemistry (1:200-1:500) The optimal working dilution should be determined by the end user.
• Gene: YOD1
• Gene Symbols: YOD1
• Immunogen: Recombinant protein corresponding to amino acids of human YOD1.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Liquid

For Research Use Only