WIPF3 Rabbit anti-Human, Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against recombinant WIPF3.

Brand:  Abnova PAB27513.100uL

Product Code. 16166420

Description

Sequence: QIESSKGTNKEGGGSANTRGASTPPTLGDLFAGGFPVLRPAGQRDVAGGKTGQGPGSRAPSPRLPNKTISGPLIPPASPRLGNTS

Specifications

• Antigen: WIPF3
• Classification: Polyclonal
• Description: Rabbit polyclonal antibody raised against recombinant WIPF3.
• Formulation: In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
• Gene Alias: CR16/FLJ36931
• Host Species: Rabbit
• Purification Method: Antigen affinity purification
• Regulatory Status: RUO
• Gene ID (Entrez): 644150
• Content And Storage: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG

• Applications: Immunohistochemistry (PFA fixed)
• Conjugate: Unconjugated
• Dilution: Immunohistochemistry (1:500-1:1000) The optimal working dilution should be determined by the end user.
• Gene: WIPF3
• Gene Symbols: WIPF3
• Immunogen: Recombinant protein corresponding to amino acids of human WIPF3.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Liquid

For Research Use Only