UTY, Rabbit, Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against recombinant UTY.

Brand:  Abnova PAB20036.100uL

Product Code. 16143170

Description

This gene encodes a protein containing tetratricopeptide repeats which are thought to be involved in protein-protein interactions. This protein is a minor histocompatibility antigen which may induce graft rejection of male stem cell grafts. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq

Sequence: SNSCILLDKCPPPRPPTSPYPPLPKDKLNPPTPSIYLENKRDAFFPPLHQFCTNPKNPVTVIRGLAGALKLDLGLFSTKTLVEANNEHMVEVRTQLLQPADENWDPTGTKKIWRCESNRSHTTI

Specifications

• Antigen: UTY
• Classification: Polyclonal
• Description: Rabbit polyclonal antibody raised against recombinant UTY.
• Formulation: In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
• Gene Alias: DKFZp686L12190/UTY1
• Host Species: Rabbit
• Purification Method: Antigen affinity purification
• Regulatory Status: RUO
• Gene ID (Entrez): 7404
• Content And Storage: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG

• Applications: Immunohistochemistry (PFA fixed)
• Conjugate: Unconjugated
• Dilution: Immunohistochemistry The optimal working dilution should be determined by the end user.
• Gene: UTY
• Gene Symbols: UTY
• Immunogen: Recombinant protein corresponding to amino acids of human UTY.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Liquid

For Research Use Only