UBXN4, Rabbit, Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against recombinant UBXN4.

Brand:  Abnova PAB22981.100uL

Product Code. 16155590

Description

UBXD2 is an integral membrane protein of the endoplasmic reticulum (ER) that binds valosin-containing protein (VCP; MIM 601023) and promotes ER-associated protein degradation (ERAD) (Liang et al., 2006 [PubMed 16968747]).[supplied by OMIM

Sequence: ERSTVARIQFRLPDGSSFTNQFPSDAPLEEARQFAAQTVGNTYGNFSLATMFPRREFTKEDYKKKLLDLELAPSASVVLLPAGRPTASIV

Specifications

• Antigen: UBXN4
• Classification: Polyclonal
• Description: Rabbit polyclonal antibody raised against recombinant UBXN4.
• Formulation: In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
• Gene Alias: FLJ23318/KIAA0242/KIAA2042/UBXD2/UBXDC1/erasin
• Host Species: Rabbit
• Purification Method: Antigen affinity purification
• Regulatory Status: RUO
• Gene ID (Entrez): 23190
• Content And Storage: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG

• Applications: Immunofluorescence, Immunohistochemistry (PFA fixed), Western Blot
• Conjugate: Unconjugated
• Dilution: Immunohistochemistry (1:50-1:200) Western Blot (1:250-1:500) Immunofluorescence (1-4 ug/mL) The optimal working dilution should be determined by the end user.
• Gene: UBXN4
• Gene Symbols: UBXN4
• Immunogen: Recombinant protein corresponding to amino acids of human UBXN4.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Liquid

For Research Use Only